PepMix™ BKV (small T antigen)
Product Code: PM-BKV-STA
Pool of 41 peptides derived from a peptide scan (15mers with 11 aa overlap) through Small t antigen (Swiss-Prot ID: P03082) of BK polyomavirus for T cell assays (antigen specific T-cell stimulation). Amount: 1 vial containing 15 nmol (appr. 25µg) per peptidePurity: >70% (HPLC-MS) Delivery Format: Freeze dried in amber type glass vial Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune responseIndication(s)/Topic(s): Infection, AIDS, Cancer chemotherapy, Transplantation, Merkel cell carcinoma, PML and BK nephropathyDelivery Time: 2-5 days
PepMix™ Peptide PoolsThe use of complete protein-spanning mixtures of overlapping peptides (PepMix) is extremely efficient for immunostimulation of T-lymphocytes and diagnostic applications. In order to establish reliable and validated T-cell assays such as ELISPOT, appropriate positive and negative controls are essential. Selection of such controls helps to confirm proper functionality of the assay as well as viability of the cells used. In addition, high quality controls are most important to establish standardized assay protocols in clinical setups. Compared to commonly used controls like phytohemagglutinin (PHA) and concanavalin A (ConA) that stimulate T-cells as well as other cell types or full length antigens, synthetic peptide pools offer the advantage of a high batch-to-batch reproducibility, applicability of reliable chemical and biochemical QC/QA measures and shelf stability when stored as freeze dried aliquots.
Benefits of PepMix™- Equivalent or better stimulation of CD4+ and CD8+ T-cell responses compared to whole protein antigens- Simultaneous detection of CD4+ and CD8+ responses in a single sample - Improved responses in stored blood and PBM cells compared to whole protein antigens
PepMix™ BKV (small T antigen)
Selected References \"In Vitro Studies of the Impact of Maribavir on CMV-Specific Cellular Immune Responses\"Stachel et al., J Clin Virol. (2015) - PMID: 26780109\"Induction Of Broad-based Immunity and Protective Efficacy by Self-amplifying mRNA Vaccines Encoding Influenza Virus Hemagglutinin\"Brazzoli et al., Journal of Virology (2015) - PMID: 26468547\"Targeting of Nucleoprotein to Chemokine Receptors by DNA Vaccination Results in Increased CD8+-mediated Cross Protection Against Influenza\"Baranowska et al., Vaccine (2015) - PMID: 26387432 \"Characteristics of Immune Memory 10-15 years After Primary Hepatitis B Vaccination\"Hummel et al., Vaccine (2015) - PMID: n.a. \"T Cells Specific for Different Latent and Lytic Viral Proteins Efficiently Control Epstein-Barr Virus Transformed B Cells\"Nowakowska et al., Cytotherapy (2015) - PMID: 26276009\"High-density Preculture of PBMCs Restores Defective Sensitivity of Circulating CD8 T Cells to Virus- and Tumor-derived Antigens\"Wegner et al., Blood (2015) - PMID: 26024876 \"Metabolic Regulation of Hepatitis B Immunopathology by Myeloid-derived Suppressor Cells\"Pallett et al., Nature Medicine (2015) - PMID: 25962123
Application Notes\"Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy\"Lam et al. (2015) Full text\"Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation\"Gary et al. (2015) Full text
Testimonials \"To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our \"go-to\" company for purchasing peptides.\" Dr. Laura J Pallett, Infection and Immunity, University College London, UK
PepMix™ BKV (small T antigen)
Technical Data:Application | Antigen specific T-cell stimulationImmune monitoringT-cell assaysT-cell expansion |
Protein Name | Small T antigen |
Organism | BK polyomavirus |
Indication / Topic | Merkel cell carcinoma |
Number of peptides | 41 |
Amount | 1 vial containing 15 nmol (appr. 25µg) per peptide |
Specifications | Peptide scan (15mers with 11 aa overlap) |
Documentation | Protocol and Datasheet |
Swiss-Prot ID | P03082 |
NCBI | YP_717941 |
Sequence | MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWSSSEVCADFPLCPDTLYCKEWPICSKKPSVHCPCMLCQLRLRHLNRKFLRKEPLVWIDCYCIDCFTQWFGLDLTEETLQWWVQIIGETPFRDLKL |
Protein Length (aa) | 172 |
本文链接: http://jpt.immuno-online.com/view-1549957376.html