A2T-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Product Code: SP-Ab-25_0.5
Variant of human Amyloid beta A4 protein, where Ala 2 is replaced by a Threonine (Thr) (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt β-sheet and other unwanted secondary structures. Amino Acid Sequence: DTEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAProtein Name: Amyloid beta (A4) (alternative names: Abeta, Beta amyloid, APP)Amount: 1 vial (0.5 mg) Purity: >90% (HPLC-MS) Delivery Format: Freeze dried in plastic vials 5Application(s): In vitro staining, Binding experiments Indication(s)/Topic(s): Neurodegenerative disease, Alzheimers diseaseDelivery Time: 2-5 days
JPTs Single Catalog Peptides JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPTs catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.
Benefits of JPTs Single Catalog Peptides - Whole production performed in a regulated European environment according to DIN EN ISO 9001:2015 & GCLP standards; audits welcome! - Synthesis protocols designed to avoid toxic contaminants and side products - Provision of freeze dried aliquots for enhanced stability - Proven track record for applications in clinical studies
A2T-Beta-Amyloid (1-42); HFIP treated (0.5mg)
Selected References \"Competitive Mirror Image Phage Display Derived Peptide Modulates Amyloid Beta Aggregation and Toxicity\" Rudolph et al., PLoS One. (2016) - PMID: 26840229\"Inhibition of the Cardiac Na+ Channel α-subunit Nav1. 5 by Propofol and Dexmedetomidine\"Stoetzer et al., Naunyn Schmiedebergs Arch Pharmacol. - PMID: 26667357\"Aβ-42 lowering Agents From the Marine-Derived Fungus Dichotomomyces Cejpii\"Harms et al., Steroids. (2015) - PMID: 26440473\"η-Secretase Processing of APP Inhibits Neuronal Activity in the Hippocampus\"Willem et al., Nature (2015) - PMID: 26322584\"Hybridization of an Aβ-specific Antibody Fragment with Aminopyrazole-based β Sheet Ligands Displays Striking Enhancement of Target Affinity\"Hellmert et al., Org. Biomol. Chem. (2015) - PMID: 25613910
Application Note \"Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation\" Broersen et al., Application Note (2013) (full text)
Testimonial“Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.”Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands
A2T-Beta-Amyloid (1-42); HFIP treated (0.5mg)

Protein Name | Amyloid beta (A4) protein |
Organism | Homo sapiens (Human) |
Indication / Topic | Alzheimers disease |
Number of peptides | 1 |
Amount | 1 vial containing 0,5 mg |
Specifications | Point mutated synthetic Beta-Amyloid peptide (1-42) |
Documentation | Product Datasheet |
Swiss-Prot ID | P05067 |
NCBI | NP_000475.1 |
Sequence | DTEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
本文链接: http://jpt.immuno-online.com/view-1547093721.html